Structure of PDB 8ccs Chain k

Receptor sequence
>8ccsk (length=184) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVAG
GKKALAIFVPVPSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPKPS
RTSRQVQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVL
LDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPS
3D structure
PDB8ccs Cryo-EM analysis of eukaryotic ribosome translocation intermediates
Chaink
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R96 R97 I98 P100 K101 R104 R107 Q108 V109 Q110 K111 R112 P113 R114 S115 R116 T117 L118 T119 T177 K179 R93 R94 I95 P97 K98 R101 R104 Q105 V106 Q107 K108 R109 P110 R111 S112 R113 T114 L115 T116 T174 K176
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ccs, PDBe:8ccs, PDBj:8ccs
PDBsum8ccs
PubMed38030725
UniProtP26786|RS7A_YEAST Small ribosomal subunit protein eS7A (Gene Name=RPS7A)

[Back to BioLiP]