Structure of PDB 8buu Chain k

Receptor sequence
>8buuk (length=115) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
NIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQ
MAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVT
PVPHNGCRPPKRRRV
3D structure
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
Chaink
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H24 R26 N30 N31 T35 G41 N42 A43 W46 S48 G50 A51 G56 K89 P119 H120 N121 C123 R124 K127 R129 R130 H8 R10 N14 N15 T19 G25 N26 A27 W30 S32 G34 A35 G40 K73 P103 H104 N105 C107 R108 K111 R113 R114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP04969|RS11_BACSU Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]