Structure of PDB 8bh6 Chain k

Receptor sequence
>8bh6k (length=118) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKST
PFAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTA
IRDVTPVPHNGCRPPKRR
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chaink
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R11 H22 R24 N28 N29 G39 N40 A41 W44 S46 A49 K53 S55 P117 H118 N119 G120 C121 R122 P124 K125 R127 R2 H13 R15 N19 N20 G30 N31 A32 W35 S37 A40 K44 S46 P108 H109 N110 G111 C112 R113 P115 K116 R118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FW31|RS11_STAA8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]