Structure of PDB 8asl Chain k

Receptor sequence
>8aslk (length=75) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
AVPATLSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFG
LGAVLGTASFGHILGAGVILGLANM
3D structure
PDB8asl The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Chaink
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA k L63 G64 L55 G56
BS02 CLA k L30 T38 I39 K40 L22 T30 I31 K32
BS03 CLA k G75 G79 N82 G67 G71 N74
BS04 CLA k W16 A21 M24 N28 H70 W8 A13 M16 N20 H62
BS05 CLA k I32 K36 N52 F53 F54 I24 K28 N44 F45 F46
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asl, PDBe:8asl, PDBj:8asl
PDBsum8asl
PubMed37542031
UniProtP72712|PSAK1_SYNY3 Photosystem I reaction center subunit PsaK 1 (Gene Name=psaK1)

[Back to BioLiP]