Structure of PDB 7ymi Chain k

Receptor sequence
>7ymik (length=37) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence]
KLPEAFSVFSPIVDVMPVIPLFFLALAFVWQAAVGFK
3D structure
PDB7ymi Structure of a large photosystem II supercomplex from Acaryochloris marina.
Chaink
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CL7 k P25 L29 P17 L21
BS02 CL7 k W38 Q39 W30 Q31
BS03 8CT k M24 I27 F30 V37 M16 I19 F22 V29
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ymi, PDBe:7ymi, PDBj:7ymi
PDBsum7ymi
PubMed38394197
UniProtB0C6Z7|PSBK_ACAM1 Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]