Structure of PDB 7unu Chain k

Receptor sequence
>7unuk (length=119) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
KVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWATSGGSGFRGSRKSTP
FAAQVAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNACGYKIASI
TDVTPIPHNGCRPPKKRRV
3D structure
PDB7unu Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chaink
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k N28 N29 T33 G39 N40 A41 W44 T46 G48 R53 K57 I116 H118 N119 G120 C121 R122 K125 R127 R128 N18 N19 T23 G29 N30 A31 W34 T36 G38 R43 K47 I106 H108 N109 G110 C111 R112 K115 R117 R118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unu, PDBe:7unu, PDBj:7unu
PDBsum7unu
PubMed
UniProtQ9HWF8|RS11_PSEAE Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]