Structure of PDB 7rcv Chain k

Receptor sequence
>7rcvk (length=37) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
KLPEAYQIFDPLVDVLPVIPLFFLALAFVWQAAVGFK
3D structure
PDB7rcv High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
Chaink
Resolution2.01 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA k P28 L32 P20 L24
BS02 CLA k F31 A35 F36 W38 Q39 F23 A27 F28 W30 Q31
BS03 CA k D18 D22 D10 D14
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7rcv, PDBe:7rcv, PDBj:7rcv
PDBsum7rcv
PubMed34937700
UniProtP15819|PSBK_SYNY3 Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]