Structure of PDB 7pir Chain k

Receptor sequence

>7pirk (length=148) Species: 272634 (Mycoplasmoides pneumoniae M129)

LNQLKSVPKARNHKTKTLGRGHGSGLGKTSGRGQKGQKARKSGLTRPGFE
GGQTPLYRRLPKFGNARKGFLKQEWVVLNLNKIAKLKLDKINRASLIEKQ
VISAKSQLPIKLIGHTKLEKPLHFEVHKVSKQALKAVENANGSVKLLE

3D structure

• PDB: 7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: k
• Resolution: 12.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	N4 Q5 L6 P10 R13 H15 K16 T17 K18 T19 L20 G21 R22 G23 H24 S26 L28 G29 K30 T31 S32 G33 G35 K37 G38 Q39 R42 K43 S44 L46 R48 F51 E52 G53 G54 Q55 T56 L58 R60 R61 L62 K64 G66 N67 A68 R69 K70 F72 K74 E76 W77 V79 K84 K87 Q102 V103 S105 A106 K107 K113 I115 G116 H117 K130 S132 K133 Q134	N2 Q3 L4 P8 R11 H13 K14 T15 K16 T17 L18 G19 R20 G21 H22 S24 L26 G27 K28 T29 S30 G31 G33 K35 G36 Q37 R40 K41 S42 L44 R46 F49 E50 G51 G52 Q53 T54 L56 R58 R59 L60 K62 G64 N65 A66 R67 K68 F70 K72 E74 W75 V77 K82 K85 Q100 V101 S103 A104 K105 K111 I113 G114 H115 K128 S130 K131 Q132

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pir, PDBe:7pir, PDBj:7pir
• PDBsum: 7pir
• PubMed: 36171285
• UniProt: Q50300|RL15_MYCPN Large ribosomal subunit protein uL15 (Gene Name=rplO)