Structure of PDB 7p7t Chain k

Receptor sequence
>7p7tk (length=96) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
IRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRAT
HKYKDSREQFEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIK
3D structure
PDB7p7t Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chaink
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R7 R9 H15 D19 S37 G38 P39 I40 P41 L42 P43 T44 R46 T50 I52 R53 A54 T55 H56 K57 Y58 K59 S61 R62 Q64 R68 H70 R72 D75 R2 R4 H10 D14 S32 G33 P34 I35 P36 L37 P38 T39 R41 T45 I47 R48 A49 T50 H51 K52 Y53 K54 S56 R57 Q59 R63 H65 R67 D70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7t, PDBe:7p7t, PDBj:7p7t
PDBsum7p7t
PubMed35387982
UniProtA0A1B4XKR5

[Back to BioLiP]