Structure of PDB 7mt3 Chain k

Receptor sequence
>7mt3k (length=117) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
KKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFA
AQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISD
VTPQPHNGVRPPKRRRV
3D structure
PDB7mt3 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chaink
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H32 N38 N39 Q48 G49 N50 V51 W54 G58 K63 G64 S65 K67 Q126 H128 N129 G130 V131 R132 K135 R137 R138 H10 N16 N17 Q26 G27 N28 V29 W32 G36 K41 G42 S43 K45 Q104 H106 N107 G108 V109 R110 K113 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mt3, PDBe:7mt3, PDBj:7mt3
PDBsum7mt3
PubMed35064151
UniProtP9WH65|RS11_MYCTU Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]