Structure of PDB 7dxh Chain k

Receptor sequence
>7dxhk (length=34) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
PEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGF
3D structure
PDB7dxh Structural insights into cyanobacterial photosystem II intermediates associated with Psb28 and Tsl0063.
Chaink
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k L35 W39 L24 W28
BS02 CLA k A36 W39 Q40 A25 W28 Q29
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dxh, PDBe:7dxh, PDBj:7dxh
PDBsum7dxh
PubMed34226692
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]