Structure of PDB 7dco Chain k

Receptor sequence

>7dcok (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQL
GLQTVIRGNSIISLEALDA

3D structure

PDB

7dco Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

Chain

Resolution

2.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	N37 R64 G65 N66	N36 R57 G58 N59

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008150	biological_process
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005737	cytoplasm
GO:0032991	protein-containing complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071004	U2-type prespliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0097526	spliceosomal tri-snRNP complex

External links

PDB	RCSB:7dco, PDBe:7dco, PDBj:7dco
PDBsum	7dco
PubMed	33243853
UniProt	P40204\|RUXG_YEAST Small nuclear ribonucleoprotein G (Gene Name=SMX2)