Structure of PDB 7czl Chain k

Receptor sequence
>7czlk (length=34) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
PEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGF
3D structure
PDB7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .
Chaink
Resolution3.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k D5019 P5020 L5021 W5039 V5043 D8 P9 L10 W28 V32
BS02 CLA k W5039 Q5040 W28 Q29
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum7czl
PubMed33495333
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]