Structure of PDB 7cou Chain k

Receptor sequence
>7couk (length=37) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB7cou Capturing structural changes of the S 1 to S 2 transition of photosystem II using time-resolved serial femtosecond crystallography.
Chaink
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k P20 L21 D23 L35 W39 R46 P11 L12 D14 L26 W30 R37
BS02 CLA k F32 W39 Q40 F23 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cou, PDBe:7cou, PDBj:7cou
PDBsum7cou
PubMed33953929
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]