Structure of PDB 7bt6 Chain k

Receptor sequence
>7bt6k (length=77) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSL
YTLVINDAGKAKKLIQSLPPTLKVNRL
3D structure
PDB7bt6 Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
Chaink
Resolution3.12 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k A2 E4 R17 K26 K42 K44 R46 S48 S50 L51 T53 A1 E3 R16 K25 K41 K43 R45 S47 S49 L50 T52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bt6, PDBe:7bt6, PDBj:7bt6
PDBsum7bt6
PubMed33037216
UniProtP49167|RL38_YEAST Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]