Structure of PDB 6uzv Chain k

Receptor sequence
>6uzvk (length=79) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence]
SPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTF
GLPELLATMSFGHILGAGMVLGLASSGIL
3D structure
PDB6uzv The structure of a red-shifted photosystem I reveals a red site in the core antenna.
Chaink
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA k P9 L78 P2 L71
BS02 CLA k L59 P60 L63 L52 P53 L56
BS03 CLA k A36 Q38 A29 Q31
BS04 CLA k G75 M76 G68 M69
BS05 CLA k M22 C23 N26 H70 M15 C16 N19 H63
BS06 CLA k F30 Y34 Q50 L51 A52 S53 K54 F57 L62 F23 Y27 Q43 L44 A45 S46 K47 F50 L55
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uzv, PDBe:6uzv, PDBj:6uzv
PDBsum6uzv
PubMed33077842
UniProtP74564|PSAK2_SYNY3 Photosystem I reaction center subunit PsaK 2 (Gene Name=psaK2)

[Back to BioLiP]