Structure of PDB 6kac Chain k

Receptor sequence
>6kack (length=37) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
KLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR
3D structure
PDB6kac Structural insight into light harvesting for photosystem II in green algae.
Chaink
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA k P29 I33 P20 I24
BS02 CLA k A36 W39 Q40 A27 W30 Q31
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kac, PDBe:6kac, PDBj:6kac
PDBsum6kac
PubMed31768031
UniProtP18263|PSBK_CHLRE Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]