Structure of PDB 6ha8 Chain k

Receptor sequence
>6ha8k (length=114) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
IESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPFAAQM
AAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIRDVTP
VPHNGCRPPKRRRV
3D structure
PDB6ha8 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
Chaink
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H24 R26 N30 N31 T35 G41 N42 A43 W46 S48 G50 A51 R55 G56 K59 K89 V118 P119 H120 N121 G122 C123 R124 P126 K127 R129 R130 V131 H7 R9 N13 N14 T18 G24 N25 A26 W29 S31 G33 A34 R38 G39 K42 K72 V101 P102 H103 N104 G105 C106 R107 P109 K110 R112 R113 V114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ha8, PDBe:6ha8, PDBj:6ha8
PDBsum6ha8
PubMed30126986
UniProtP04969|RS11_BACSU Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]