Structure of PDB 6gxp Chain k

Receptor sequence
>6gxpk (length=112) Species: 562 (Escherichia coli) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPP
3D structure
PDB6gxp Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
Chaink
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H21 H23 N27 N28 I30 G38 N39 A40 W43 G47 G48 R52 G53 S54 K56 K86 D111 T113 P114 I115 P116 H117 N118 G119 C120 P122 H10 H12 N16 N17 I19 G27 N28 A29 W32 G36 G37 R41 G42 S43 K45 K75 D100 T102 P103 I104 P105 H106 N107 G108 C109 P111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gxp, PDBe:6gxp, PDBj:6gxp
PDBsum6gxp
PubMed30076302
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]