Structure of PDB 6gqv Chain k

Receptor sequence
>6gqvk (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSL
YTLVINDAGKAKKLIQSLPPTLKVNRL
3D structure
PDB6gqv Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
Chaink
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k A2 R3 R17 K26 N28 K42 K44 R46 S49 S50 T53 L78 A1 R2 R16 K25 N27 K41 K43 R45 S48 S49 T52 L77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gqv, PDBe:6gqv, PDBj:6gqv
PDBsum6gqv
PubMed29886014
UniProtP49167|RL38_YEAST Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]