Structure of PDB 6c4i Chain k

Receptor sequence

>6c4ik (length=117) Species: 562 (Escherichia coli) [Search protein sequence]

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

PDB

6c4i Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.

Chain

Resolution

3.24 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	H22 N28 N29 I31 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 P117 H118 N119 G120 C121 R122 P123 P124 K125 R127 R128 V129	H10 N16 N17 I19 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 P103 I104 P105 H106 N107 G108 C109 R110 P111 P112 K113 R115 R116 V117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6c4i, PDBe:6c4i, PDBj:6c4i
PDBsum	6c4i
PubMed	29403017
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)