Structure of PDB 5zwo Chain k |
>5zwok (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQL GLQTVIRGNSIISLEALDA |
|
PDB | 5zwo Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation |
Chain | k |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
k |
F35 G65 |
F34 G58 |
|
|
|
|