Structure of PDB 5zeu Chain k

Receptor sequence
>5zeuk (length=117) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFA
AQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISD
VTPQPHNGCRPPKRRRV
3D structure
PDB5zeu Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
Chaink
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H31 N37 N38 S42 G48 N49 W53 S55 G57 H58 G63 S64 K66 H127 N128 C130 R131 R136 R137 H10 N16 N17 S21 G27 N28 W32 S34 G36 H37 G42 S43 K45 H106 N107 C109 R110 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zeu, PDBe:5zeu, PDBj:5zeu
PDBsum5zeu
PubMed30206241
UniProtA0QSL6|RS11_MYCS2 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]