Structure of PDB 5uq7 Chain k

Receptor sequence

>5uq7k (length=114) Species: 300852 (Thermus thermophilus HB8)

QVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQ
LAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDT
PVPHNGCRPKKKFR

3D structure

• PDB: 5uq7 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.
• Chain: k
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G45 G46 V47 G52 S53 K55 R85 P113 V114 P115 H116 N117 G118 C119 R120 P121 K122 K123 R126	Y8 H10 N14 N15 I17 T19 G25 N26 P27 W30 S32 G33 G34 V35 G40 S41 K43 R73 P101 V102 P103 H104 N105 G106 C107 R108 P109 K110 K111 R114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5uq7, PDBe:5uq7, PDBj:5uq7
• PDBsum: 5uq7
• PubMed: 29456023
• UniProt: P80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)