Structure of PDB 5tbw Chain k

Receptor sequence

>5tbwk (length=386) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

PDB

5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	S2 H3 R4 K5 E7 A8 P9 R10 H11 G12 H13 L14 G15 F16 L17 P18 R19 K20 R21 R26 R28 K30 A31 K50 M53 T54 T55 R62 S65 A75 Y92 T95 R97 L99 R100 S101 T103 T104 R116 R117 F118 Y119 K120 N121 Y123 K124 S125 K126 K128 A129 F130 T131 K132 Y133 R150 K153 Y154 R159 Q173 K174 K175 E180 K222 G223 H224 G225 F226 G228 R232 K236 K237 R240 K241 T242 H243 R244 G245 R247 K248 V249 A250 C251 I252 G253 A254 W255 H256 P257 A258 H259 V260 W262 S263 R266 A267 Q269 R270 Y272 S274 R275 T276 I278 N279 M308 G309 H313 K325 C327 I328 P329 G330 R332 K333 R334 Y343 S363 K364 F365 G366 K376 M380 L383 K384 K385	S1 H2 R3 K4 E6 A7 P8 R9 H10 G11 H12 L13 G14 F15 L16 P17 R18 K19 R20 R25 R27 K29 A30 K49 M52 T53 T54 R61 S64 A74 Y91 T94 R96 L98 R99 S100 T102 T103 R115 R116 F117 Y118 K119 N120 Y122 K123 S124 K125 K127 A128 F129 T130 K131 Y132 R149 K152 Y153 R158 Q172 K173 K174 E179 K221 G222 H223 G224 F225 G227 R231 K235 K236 R239 K240 T241 H242 R243 G244 R246 K247 V248 A249 C250 I251 G252 A253 W254 H255 P256 A257 H258 V259 W261 S262 R265 A266 Q268 R269 Y271 S273 R274 T275 I277 N278 M307 G308 H312 K324 C326 I327 P328 G329 R331 K332 R333 Y342 S362 K363 F364 G365 K375 M379 L382 K383 K384
BS02	OHX	k	R167 T169 P170 L171 A172	R166 T168 P169 L170 A171

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
PDBsum	5tbw
PubMed	29064494
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]