Structure of PDB 5nd9 Chain k

Receptor sequence
>5nd9k (length=115) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
KKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFA
AQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRD
VTPVPHNGCRPPKRR
3D structure
PDB5nd9 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF.
Chaink
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R24 N28 N29 N40 A41 W44 S46 A49 G54 P117 H118 N119 G120 K125 R126 R12 N16 N17 N28 A29 W32 S34 A37 G42 P105 H106 N107 G108 K113 R114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nd9, PDBe:5nd9, PDBj:5nd9
PDBsum5nd9
PubMed28645916
UniProtQ2FW31|RS11_STAA8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]