Structure of PDB 5l3p Chain k

Receptor sequence
>5l3pk (length=116) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRR
3D structure
PDB5l3p The stringent factor RelA adopts an open conformation on the ribosome to stimulate ppGpp synthesis.
Chaink
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k H21 H23 N27 N28 I30 G38 A40 W43 T45 G48 R52 K86 P114 I115 P116 H117 N118 G119 C120 R121 P123 K124 R126 R127 H10 H12 N16 N17 I19 G27 A29 W32 T34 G37 R41 K75 P103 I104 P105 H106 N107 G108 C109 R110 P112 K113 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l3p, PDBe:5l3p, PDBj:5l3p
PDBsum5l3p
PubMed27226493
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]