Structure of PDB 5imq Chain k

Receptor sequence
>5imqk (length=110) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chaink
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna k R3 L4 E8 K11 F12 R15 R20 T21 F87 Y94 R1 L2 E6 K9 F10 R13 R18 T19 F85 Y92
BS02 rna k R25 F29 R30 K33 H34 Q38 E43 G45 T47 G60 N61 K62 T63 Y92 H95 G96 R97 R23 F27 R28 K31 H32 Q36 E41 G43 T45 G58 N59 K60 T61 Y90 H93 G94 R95
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]