Structure of PDB 5e7c Chain k

Receptor sequence
>5e7ck (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB5e7c Macromolecular diffractive imaging using imperfect crystals.
Chaink
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k P20 D23 L35 W39 V43 R46 P11 D14 L26 W30 V34 R37
BS02 CLA k P29 L33 P20 L24
BS03 CLA k F32 A36 W39 Q40 F23 A27 W30 Q31
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e7c, PDBe:5e7c, PDBj:5e7c
PDBsum5e7c
PubMed26863980
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]