Structure of PDB 4pj0 Chain k

Receptor sequence
>4pj0k (length=36) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
LPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
3D structure
PDB4pj0 Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
Chaink
Resolution2.437 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide k V24 W39 V43 V14 W29 V33
BS02 CLA k P29 L33 P19 L23
BS03 CLA k F32 W39 Q40 F22 W29 Q30
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pj0, PDBe:4pj0, PDBj:4pj0
PDBsum4pj0
PubMed25438669
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]