Structure of PDB 3jcj Chain k

Receptor sequence

>3jcjk (length=150) Species: 562 (Escherichia coli)

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK

3D structure

• PDB: 3jcj Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
• Chain: k
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	N18 V20 S21 K22 T23 V24 K25 G26 R28 Y49 K51 R53 K61 E64 R68 H88 T89 R92 F94 A98 A106 G107 R111 L123 K125 Y127 S129 T130 N131 I133 N134	N10 V12 S13 K14 T15 V16 K17 G18 R20 Y41 K43 R45 K53 E56 R60 H80 T81 R84 F86 A90 A98 G99 R103 L115 K117 Y119 S121 T122 N123 I125 N126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jcj, PDBe:3jcj, PDBj:3jcj
• PDBsum: 3jcj
• PubMed: 26973877
• UniProt: P0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)