Structure of PDB 3jb9 Chain k

Receptor sequence

>3jb9k (length=89) Species: 284812 (Schizosaccharomyces pombe 972h-)

TLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFF
DPSAAAIAMKALKNFIFFGKEMKIQYAHSKSKIIERIVA

3D structure

• PDB: 3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
• Chain: k
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	k	Y7 N9 N10 D13 K14 K17 V38 A39 L40 K41 K44 M45 R46 Q48 H50 K74 Q79 A81 H82 S83 K84 S85 K86	Y3 N5 N6 D9 K10 K13 V34 A35 L36 K37 K40 M41 R42 Q44 H46 K70 Q75 A77 H78 S79 K80 S81 K82

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030620 U2 snRNA binding

Biological Process

• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
• PDBsum: 3jb9
• PubMed: 26292707
• UniProt: Q7LL14|RU2B_SCHPO Probable U2 small nuclear ribonucleoprotein B'' (Gene Name=msl1)