Structure of PDB 5lzt Chain jj

Receptor sequence

>5lztjj (length=428) Species: 9606 (Homo sapiens)

APKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNR
ETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPN
MIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVL
INKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGAN
LKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVL
GKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKG
IEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHT
CIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETF
KDFPQMGRFTLRDEGKTIAIGKVLKLVP

3D structure

• PDB: 5lzt Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
• Chain: jj
• Resolution: 3.65 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	jj	R256 H300 R324	R50 H94 R118
BS02	rna	jj	K449 M451 G452	K243 M245 G246
BS03	MG	jj	S226 T277	S20 T71

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003747 translation release factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000082 G1/S transition of mitotic cell cycle
• GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
• GO:0006412 translation
• GO:0006415 translational termination
• GO:0006449 regulation of translational termination
• GO:0006479 protein methylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0018444 translation release factor complex
• GO:0022626 cytosolic ribosome

External links

• PDB: RCSB:5lzt, PDBe:5lzt, PDBj:5lzt
• PDBsum: 5lzt
• PubMed: 27863242
• UniProt: P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A (Gene Name=GSPT1)