Structure of PDB 5it7 Chain jj

Receptor sequence

>5it7jj (length=85) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

GKGTPSFGKRHNKSHTLCKRCGRSSYHIQKHTCSSCGYPAAKMRSHNWAA
KAKRRRTTGTGRMRYLKHVSRRFKNGFQSGEAKAQ

3D structure

PDB

5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	jj	G2 K3 G4 T5 P6 S7 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 S25 S26 H28 Q30 K31 S35 K43 M44 R45 H47 N48 W49 K52 A53 R55 R56	G1 K2 G3 T4 P5 S6 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 S24 S25 H27 Q29 K30 S34 K42 M43 R44 H46 N47 W48 K51 A52 R54 R55
BS02	rna	jj	T17 K20 R21 G23 Y27 I29 Y39 M44 R57 T59 G60 G62 R63 M64 R65 Y66 L67 K68 H69 R72 F74 K75 N76 F78 Q79 S80 G81 E82 A83 K84 Q86	T16 K19 R20 G22 Y26 I28 Y38 M43 R56 T58 G59 G61 R62 M63 R64 Y65 L66 K67 H68 R71 F73 K74 N75 F77 Q78 S79 G80 E81 A82 K83 Q85
BS03	ZN	jj	C19 C34 C37	C18 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links