Structure of PDB 5y6p Chain jM

Receptor sequence
>5y6pjM (length=145) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
DGNKRLDAVNCIVSNASCIVSDAISGMICENPGLIAPGGNCYTNRRMAAC
LRDGEIILRYVSYALLAGDSSVLDDRCLNGLKETYIALGVPTASTSRAVS
IMKAASTAFIMNTASGRKIEIAAGDCQALQSEAAAYFDKVGSAVD
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainjM
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB jM R78 A81 C82 R84 D85 V122 P123 R46 A49 C50 R52 D53 V90 P91
BS02 PEB jM N35 L38 D39 I153 A154 A155 G156 N3 L6 D7 I121 A122 A123 G124
BS03 PUB jM C50 D54 S57 G58 C61 R129 I133 A137 A140 F141 C18 D22 S25 G26 C29 R97 I101 A105 A108 F109
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 15:24:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'jM', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='jM', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'jM'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='jM')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>