Structure of PDB 5y6p Chain jJ

Receptor sequence
>5y6pjJ (length=144) Species: 35689 (Griffithsia pacifica) [Search protein sequence]
GNKRLDAVNCIVSNASCIVSDAISGMICENPGLIAPGGNCYTNRRMAACL
RDGEIILRYVSYALLAGDSSVLDDRCLNGLKETYIALGVPTASTSRAVSI
MKAASTAFIMNTASGRKIEIAAGDCQALQSEAAAYFDKVGSAVD
3D structure
PDB5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
ChainjJ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 PEB jJ R78 A81 C82 R84 D85 R45 A48 C49 R51 D52
BS02 PEB jJ N35 K36 L38 D39 I153 A154 A155 G156 C158 N2 K3 L5 D6 I120 A121 A122 G123 C125
BS03 PUB jJ C50 D54 C61 A136 F141 A146 C17 D21 C28 A103 F108 A113
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Nov 28 16:58:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'jJ', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='jJ', title='Structure of phycobilisome from the red alga Griffithsia pacifica')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'jJ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='jJ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>