Structure of PDB 7pwo Chain j2

Receptor sequence

>7pwoj2 (length=87) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

SKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWSY
KSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKYLA

3D structure

PDB

7pwo Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.

Chain

Resolution

2.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j2	S2 K3 T5 A6 F8 G9 K10 R11 H12 T13 R14 I15 H16 H25 S26 H28 Q30 K31 A35 K43 M44 R45 Y47 N48 W49 Y51 K52 S53 R55 R56	S1 K2 T4 A5 F7 G8 K9 R10 H11 T12 R13 I14 H15 H24 S25 H27 Q29 K30 A34 K42 M43 R44 Y46 N47 W48 Y50 K51 S52 R54 R55
BS02	rna	j2	R20 R21 C22 G23 Q59 G60 G62 M64 H66 M67 R68 V70 Y71 R72 Y74 G77 T78	R19 R20 C21 G22 Q58 G59 G61 M63 H65 M66 R67 V69 Y70 R71 Y73 G76 T77

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links