Structure of PDB 7oyb Chain j1

Receptor sequence

>7oybj1 (length=86) Species: 7955 (Danio rerio) [Search protein sequence]

TKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSA
KAKRRSTTGTGRMRHMKVVFRRFRNGFREGTVPKPR

3D structure

PDB

7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	j1	T2 K3 G4 T5 S6 S7 F8 G9 K10 R11 R12 N13 K14 T15 H16 K25 A26 H28 Q30 G35 K42 R43 K44 R45 K46 Y47 N48 W49 S50 K52 A53 R55 R56 T59 F71 K85	T1 K2 G3 T4 S5 S6 F7 G8 K9 R10 R11 N12 K13 T14 H15 K24 A25 H27 Q29 G34 K41 R42 K43 R44 K45 Y46 N47 W48 S49 K51 A52 R54 R55 T58 F70 K84
BS02	rna	j1	R20 R21 C22 G23 Y27 L29 Y39 T59 G60 G62 R63 M64 R65 H66 M67 F71 R72 F74 R75 N76 R79 T82 V83 P84 K85 P86 R87	R19 R20 C21 G22 Y26 L28 Y38 T58 G59 G61 R62 M63 R64 H65 M66 F70 R71 F73 R74 N75 R78 T81 V82 P83 K84 P85 R86
BS03	ZN	j1	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0032981	mitochondrial respiratory chain complex I assembly
GO:0033617	mitochondrial cytochrome c oxidase assembly

	Cellular Component
GO:0005743	mitochondrial inner membrane
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links