Structure of PDB 4yuu Chain j1

Receptor sequence
>4yuuj1 (length=32) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
PLWLVVTFGGIVVLTVLGIFIYGSYSGLGSSL
3D structure
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Chainj1
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide j1 I27 F28 L36 L40 I19 F20 L28 L32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TM23|PSBJ_CYACA Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]