Structure of PDB 8wid Chain j

Receptor sequence

>8widj (length=126) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PIQTVGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVT
VDRVDQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFL
TRDPRAIERKKYGLKKARKAPQYSKR

3D structure

• PDB: 8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: j
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	Q27 V29 R31 R32 K33 E34 R38 R40 H86 G89 G90 G91 S93 Q95 R115 K119 T125 R126 R129 A130 I131 E132 R133 K134 K135 Y136 G137 K139 K140 R142 K143 A144 Q146 Y147 S148	Q3 V5 R7 R8 K9 E10 R14 R16 H62 G65 G66 G67 S69 Q71 R91 K95 T101 R102 R105 A106 I107 E108 R109 K110 K111 Y112 G113 K115 K116 R118 K119 A120 Q122 Y123 S124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wid, PDBe:8wid, PDBj:8wid
• PDBsum: 8wid
• PubMed: 38245551
• UniProt: A0QSP9|RS9_MYCS2 Small ribosomal subunit protein uS9 (Gene Name=rpsI)