Structure of PDB 8v9l Chain j

Receptor sequence
>8v9lj (length=99) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
GQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVI
RSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ
3D structure
PDB8v9l A new family of bacterial ribosome hibernation factors
Chainj
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R7 R9 H15 V40 P41 L42 P43 T44 N47 R53 S54 P55 H56 K57 Y58 K59 S61 R62 H64 H70 K71 L73 R5 R7 H13 V38 P39 L40 P41 T42 N45 R51 S52 P53 H54 K55 Y56 K57 S59 R60 H62 H68 K69 L71
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum8v9l
PubMed38355796
UniProtA0QSD0|RS10_MYCS2 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]