Structure of PDB 8qpp Chain j

Receptor sequence

>8qppj (length=135) Species: 1423 (Bacillus subtilis) [Search protein sequence]

MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPG
KVLFEISGVSEEVAREALRLASHKLPIKTKFVKRE

3D structure

PDB

8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K16 R18 G19	K16 R18 G19
BS02	rna	j	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 G23 G24 H28 R45 Q46 R56 W65 F69 K77 E80 R82 M83 G84 S85 G86 K87 K101 H123 K124 P126 K128	P4 K5 R6 K8 Y9 R11 E12 H13 R14 G15 K16 M17 R18 K22 G23 G24 H28 R45 Q46 R56 W65 F69 K77 E80 R82 M83 G84 S85 G86 K87 K101 H123 K124 P126 K128

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links