Structure of PDB 8qcq Chain j

Receptor sequence
>8qcqj (length=98) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRA
VHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL
3D structure
PDB8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
Chainj
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R7 R9 H15 S37 P39 I40 P41 L42 P43 T44 T50 L52 R53 A54 V55 H56 K57 Y58 K59 S61 R62 Q64 R68 H70 R72 L73 R3 R5 H11 S33 P35 I36 P37 L38 P39 T40 T46 L48 R49 A50 V51 H52 K53 Y54 K55 S57 R58 Q60 R64 H66 R68 L69
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
PDBsum8qcq
PubMed38503735
UniProtP21471|RS10_BACSU Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]