Structure of PDB 8p2h Chain j

Receptor sequence

>8p2hj (length=128) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

QVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPF
DVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAG
LLTRDPRMKERKKPGLKAARRSPQFSKR

3D structure

PDB

8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state

Chain

Resolution

2.49 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K131 R132	K127 R128
BS02	rna	j	R9 T11 R13 R14 K15 N16 V18 R20 R22 Y40 F43 N68 H70 G71 G72 G73 F74 T75 G76 Q77 R87 R97 K101 L106 T107 R108 P110 R111 M112 K113 E114 R115 K116 K117 P118 G119 K121 R124 R125 S126 Q128 F129 S130 K131 R132	R5 T7 R9 R10 K11 N12 V14 R16 R18 Y36 F39 N64 H66 G67 G68 G69 F70 T71 G72 Q73 R83 R93 K97 L102 T103 R104 P106 R107 M108 K109 E110 R111 K112 K113 P114 G115 K117 R120 R121 S122 Q124 F125 S126 K127 R128

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
PDBsum	8p2h
PubMed	38902339
UniProt	Q2FW39\|RS9_STAA8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)