Structure of PDB 8ovj Chain j

Receptor sequence

>8ovjj (length=81) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFKTPK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	j	G4 T5 Q10 R11 H12 G13 R14 T15 H16 R24 N25 S26 H28 Q30 R33 A35 R41 R45 R46 Y47 N48 W49 V51 K52 R56 R58 T59 K79 T80 K82	G3 T4 Q9 R10 H11 G12 R13 T14 H15 R23 N24 S25 H27 Q29 R32 A34 R40 R44 R45 Y46 N47 W48 V50 K51 R55 R57 T58 K78 T79 K81
BS02	rna	j	R20 R21 C22 R44 T59 G62 R63 C64 R65 Y66 L67 R72 R73 N76 H77 K79 T80 P81	R19 R20 C21 R43 T58 G61 R62 C63 R64 Y65 L66 R71 R72 N75 H76 K78 T79 P80
BS03	rna	j	K3 T5 T6 M8 G9 Q10	K2 T4 T5 M7 G8 Q9
BS04	ZN	j	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links