Structure of PDB 8jw0 Chain j

Receptor sequence
>8jw0j (length=70) Species: 2961 (Amphidinium carterae) [Search protein sequence]
RKIPAGPYSVSVEPLRDGATNEVSIVTPPISSEGVQEYLSLAPVFFMALA
IFTSGFAIEVLRFFPDTRYW
3D structure
PDB8jw0 Structures and organizations of PSI-AcpPCI supercomplexes from red tidal and coral symbiotic photosynthetic dinoflagellates.
Chainj
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLA j Y8 P28 I30 Y38 Y8 P28 I30 Y38
BS02 CLA j F46 A50 F46 A50
BS03 CLA j F56 V60 L61 D66 T67 F56 V60 L61 D66 T67
BS04 PID j Y38 V44 M47 I58 R62 Y38 V44 M47 I58 R62
BS05 CLA j I51 F52 G55 F56 E59 R62 F63 I51 F52 G55 F56 E59 R62 F63
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 03:30:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jw0', asym_id = 'j', title = 'Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jw0', asym_id='j', title='Structures and organizations of PSI-AcpPCI super...d coral symbiotic photosynthetic dinoflagellates.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0009522,0015979', uniprot = '', pdbid = '8jw0', asym_id = 'j'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009522,0015979', uniprot='', pdbid='8jw0', asym_id='j')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>