Structure of PDB 8ev3 Chain j

Receptor sequence

>8ev3j (length=71) Species: 4896 (Schizosaccharomyces pombe)

KSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGR
MSYLKKVHRSFKNGFRSGKPA

3D structure

• PDB: 8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: j
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	H16 K24 R25 S26 H28 K31 A35 K43 T44 R45 Y47 N48 W49 K52 K54 R55 R56 K75 G77 R79 S80 G81	H3 K11 R12 S13 H15 K18 A22 K30 T31 R32 Y34 N35 W36 K39 K41 R42 R43 K62 G64 R66 S67 G68
BS02	rna	j	R20 R21 C22 G23 Y39 T59 G60 G62 R63 M64 Y66 L67 H71 F74 K75 N76 F78 R79 S80 G81 P83	R7 R8 C9 G10 Y26 T46 G47 G49 R50 M51 Y53 L54 H58 F61 K62 N63 F65 R66 S67 G68 P70
BS03	ZN	j	C19 C34 C37	C6 C21 C24

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
• PDBsum: 8ev3
• PubMed: 36423630
• UniProt: P05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)