Structure of PDB 8euy Chain j

Receptor sequence

>8euyj (length=71) Species: 4896 (Schizosaccharomyces pombe)

KSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGR
MSYLKKVHRSFKNGFRSGKPA

3D structure

• PDB: 8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: j
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	S15 H16 K24 R25 S26 H28 K31 A35 A42 K43 T44 R45 Y47 N48 W49 K52 A53 R55 R56 R57 H71 G77 S80 G81	S2 H3 K11 R12 S13 H15 K18 A22 A29 K30 T31 R32 Y34 N35 W36 K39 A40 R42 R43 R44 H58 G64 S67 G68
BS02	rna	j	R20 R21 C22 G23 T59 G60 T61 G62 R63 M64 Y66 L67 F74 K75 N76 F78 R79 S80 G81	R7 R8 C9 G10 T46 G47 T48 G49 R50 M51 Y53 L54 F61 K62 N63 F65 R66 S67 G68
BS03	ZN	j	C19 C22 C34	C6 C9 C21

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8euy, PDBe:8euy, PDBj:8euy
• PDBsum: 8euy
• PubMed: 36423630
• UniProt: P05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)