Structure of PDB 8eui Chain j

Receptor sequence

>8euij (length=83) Species: 4896 (Schizosaccharomyces pombe)

TKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGA
KAKRRRTTGTGRMSYLKKVHRSFKNGFRSGKPA

3D structure

• PDB: 8eui Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: j
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	T2 K3 G4 T5 Q6 S7 F8 G9 M10 R11 H12 N13 K14 S15 H16 K24 S26 H28 Q30 K31 A35 K43 T44 R45 Y47 N48 W49 K52 A53 R55 R56 T59 H71 G77 S80 G81	T1 K2 G3 T4 Q5 S6 F7 G8 M9 R10 H11 N12 K13 S14 H15 K23 S25 H27 Q29 K30 A34 K42 T43 R44 Y46 N47 W48 K51 A52 R54 R55 T58 H70 G76 S79 G80
BS02	rna	j	R20 R21 C22 G23 I29 T59 G60 G62 R63 M64 Y66 L67 K68 R72 F74 N76 F78 R79 G81 K82 P83	R19 R20 C21 G22 I28 T58 G59 G61 R62 M63 Y65 L66 K67 R71 F73 N75 F77 R78 G80 K81 P82
BS03	ZN	j	C19 C22 C34	C18 C21 C33

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eui, PDBe:8eui, PDBj:8eui
• PDBsum: 8eui
• PubMed: 36423630
• UniProt: P05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)