Structure of PDB 8cmj Chain j

Receptor sequence

>8cmjj (length=219) Species: 4932 (Saccharomyces cerevisiae)

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGA
IVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKE
DDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQA
QREAAAEYAQLLAKRLSER

3D structure

• PDB: 8cmj Cryo-EM analysis of eukaryotic ribosome translocation intermediates
• Chain: j
• Resolution: 3.79 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K2 N4 Q13 T15 R31 S53 G54 N56 Q59 G60 Q65 G66 K74 L76 C83 Y84 R85 R87 R88 D89 E91 R92 R94 K95 S96 A110 R132 L133 K136 R137 N139 N140 K143 K149 D152 R154 R160 K167 A172 P173 K174 I175 Q176 R177 L178 V179 R183 L184 Q185 R186 K187 R188 H189 Q190 R191 K194 V195 N197 Q199 Q201 R202	K2 N4 Q13 T15 R31 S53 G54 N56 Q59 G60 Q65 G66 K74 L76 C83 Y84 R85 R87 R88 D89 E91 R92 R94 K95 S96 A110 R132 L133 K136 R137 N139 N140 K143 K149 D152 R154 R160 K167 A172 P173 K174 I175 Q176 R177 L178 V179 R183 L184 Q185 R186 K187 R188 H189 Q190 R191 K194 V195 N197 Q199 Q201 R202

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cmj, PDBe:8cmj, PDBj:8cmj
• PDBsum: 8cmj
• PubMed: 38030725
• UniProt: P0CX37|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)